SCOPe 2.03: Domain d3w3da2: 3w3d A:146-374

Lineage for d3w3da2 (3w3d A:146-374)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (10 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [226582] (1 PDB entry)

8. Domain d3w3da2: 3w3d A:146-374 [201269]
   Other proteins in same PDB: d3w3da1, d3w3db_
   automated match to d1d4xa2
   complexed with atp, ca

Details for d3w3da2

PDB Entry: 3w3d, 1.8 Å

PDB Description: crystal structure of smooth muscle g actin dnase i complex

PDB Compounds: (A:) Actin, gamma-enteric smooth muscle

SCOPe Domain Sequences for d3w3da2:

Sequence; same for both SEQRES and ATOM records:

>d3w3da2 c.55.1.1 (A:146-374) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydeagpsivhrkcf

Timeline for d3w3da2:

• d3w3da2 is new in SCOPe 2.03-stable
  
• d3w3da2 appears in SCOPe 2.04
  
• d3w3da2 appears in the current release, SCOPe 2.08