![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (35 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [226581] (1 PDB entry) |
![]() | Domain d3w3da1: 3w3d A:1-145 [201268] Other proteins in same PDB: d3w3da2, d3w3db_ automated match to d1d4xa1 complexed with atp, ca |
PDB Entry: 3w3d (more details), 1.8 Å
SCOPe Domain Sequences for d3w3da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w3da1 c.55.1.0 (A:1-145) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} eeettalvcdngsglckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk rgiltlkypiehgiitnwddmekiwhhsfynelrvapeehptllteaplnpkanrekmtq imfetfnvpamyvaiqavlslyasg
Timeline for d3w3da1: