Lineage for d3w3da1 (3w3d A:1-145)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373390Species Chicken (Gallus gallus) [TaxId:9031] [226581] (1 PDB entry)
  8. 1373391Domain d3w3da1: 3w3d A:1-145 [201268]
    Other proteins in same PDB: d3w3da2, d3w3db_
    automated match to d1d4xa1
    complexed with atp, ca

Details for d3w3da1

PDB Entry: 3w3d (more details), 1.8 Å

PDB Description: crystal structure of smooth muscle g actin dnase i complex
PDB Compounds: (A:) Actin, gamma-enteric smooth muscle

SCOPe Domain Sequences for d3w3da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w3da1 c.55.1.0 (A:1-145) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
eeettalvcdngsglckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgiitnwddmekiwhhsfynelrvapeehptllteaplnpkanrekmtq
imfetfnvpamyvaiqavlslyasg

SCOPe Domain Coordinates for d3w3da1:

Click to download the PDB-style file with coordinates for d3w3da1.
(The format of our PDB-style files is described here.)

Timeline for d3w3da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3w3da2
View in 3D
Domains from other chains:
(mouse over for more information)
d3w3db_