Lineage for d3w3da2 (3w3d A:146-374)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2883864Species Chicken (Gallus gallus) [TaxId:9031] [226582] (6 PDB entries)
  8. 2883865Domain d3w3da2: 3w3d A:146-374 [201269]
    Other proteins in same PDB: d3w3da1, d3w3db_
    automated match to d1d4xa2
    complexed with atp, ca

Details for d3w3da2

PDB Entry: 3w3d (more details), 1.8 Å

PDB Description: crystal structure of smooth muscle g actin dnase i complex
PDB Compounds: (A:) Actin, gamma-enteric smooth muscle

SCOPe Domain Sequences for d3w3da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w3da2 c.55.1.1 (A:146-374) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydeagpsivhrkcf

SCOPe Domain Coordinates for d3w3da2:

Click to download the PDB-style file with coordinates for d3w3da2.
(The format of our PDB-style files is described here.)

Timeline for d3w3da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3w3da1
View in 3D
Domains from other chains:
(mouse over for more information)
d3w3db_