Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries) |
Domain d3ut5a2: 3ut5 A:246-440 [201112] Other proteins in same PDB: d3ut5a1, d3ut5b1, d3ut5c1, d3ut5d1, d3ut5e1, d3ut5e2 automated match to d1z2ba2 complexed with gdp, gtp, loc, mg, so4 |
PDB Entry: 3ut5 (more details), 2.73 Å
SCOPe Domain Sequences for d3ut5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ut5a2 d.79.2.1 (A:246-440) automated matches {Sheep (Ovis aries) [TaxId: 9940]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d3ut5a2: