Lineage for d3ut5e1 (3ut5 E:5-141)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733934Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)
  8. 2734018Domain d3ut5e1: 3ut5 E:5-141 [194854]
    Other proteins in same PDB: d3ut5a1, d3ut5a2, d3ut5b1, d3ut5b2, d3ut5c1, d3ut5c2, d3ut5d1, d3ut5d2, d3ut5e2
    automated match to d3ryce_
    complexed with gdp, gtp, loc, mg, so4

Details for d3ut5e1

PDB Entry: 3ut5 (more details), 2.73 Å

PDB Description: Tubulin-Colchicine-Ustiloxin: Stathmin-like domain complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d3ut5e1:

Sequence, based on SEQRES records: (download)

>d3ut5e1 a.137.10.1 (E:5-141) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dmevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyq
eaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlq
ekdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d3ut5e1 a.137.10.1 (E:5-141) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dmevielnkatsgqswevilkppsfdgvperrrdpsleeiqkkleaaeerrkyqeaellk
hlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkha
eevrknkelke

SCOPe Domain Coordinates for d3ut5e1:

Click to download the PDB-style file with coordinates for d3ut5e1.
(The format of our PDB-style files is described here.)

Timeline for d3ut5e1: