SCOPe 2.08: Domain d3ut5e1: 3ut5 E:5-141

Lineage for d3ut5e1 (3ut5 E:5-141)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d3ut5e1: 3ut5 E:5-141 [194854]
   Other proteins in same PDB: d3ut5a1, d3ut5a2, d3ut5b1, d3ut5b2, d3ut5c1, d3ut5c2, d3ut5d1, d3ut5d2, d3ut5e2
   automated match to d3ryce_
   complexed with gdp, gtp, loc, mg, so4

Details for d3ut5e1

PDB Entry: 3ut5, 2.73 Å

PDB Description: Tubulin-Colchicine-Ustiloxin: Stathmin-like domain complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d3ut5e1:

Sequence, based on SEQRES records:

>d3ut5e1 a.137.10.1 (E:5-141) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dmevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyq
eaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlq
ekdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d3ut5e1 a.137.10.1 (E:5-141) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dmevielnkatsgqswevilkppsfdgvperrrdpsleeiqkkleaaeerrkyqeaellk
hlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkha
eevrknkelke

Timeline for d3ut5e1:

• d3ut5e1 first appeared in SCOPe 2.02, called d3ut5e_
  
• d3ut5e1 appears in SCOPe 2.07