Class a: All alpha proteins [46456] (285 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
Protein Interferon-alpha 2a [47314] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47315] (6 PDB entries) |
Domain d3s9da_: 3s9d A: [200600] Other proteins in same PDB: d3s9db1, d3s9db2, d3s9dd1, d3s9dd2 automated match to d3s9dc_ complexed with cl |
PDB Entry: 3s9d (more details), 2 Å
SCOPe Domain Sequences for d3s9da_:
Sequence, based on SEQRES records: (download)
>d3s9da_ a.26.1.3 (A:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]} slgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgnqfqkaetipvlaamiaqifnlf stkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavrkyfqrit lylkekkyspcawevvraeimrsfslstn
>d3s9da_ a.26.1.3 (A:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]} slgsrrtlmllaqmrrislfsclkdrhdfgfpqeefetipvlaamiaqifnlfstkdssa awdetlldkfytelyqqlndleacdsilavrkyfqritlylkekkyspcawevvraeimr sfslstn
Timeline for d3s9da_: