SCOPe 2.04: Domain d3s9db1: 3s9d B:12-109

Lineage for d3s9db1 (3s9d B:12-109)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (24 PDB entries)

8. Domain d3s9db1: 3s9d B:12-109 [233523]
   Other proteins in same PDB: d3s9da_, d3s9dc_
   automated match to d2hyma1
   complexed with cl

Details for d3s9db1

PDB Entry: 3s9d, 2 Å

PDB Description: binary complex between IFNa2 and IFNAR2

PDB Compounds: (B:) Interferon alpha/beta receptor 2

SCOPe Domain Sequences for d3s9db1:

Sequence, based on SEQRES records:

>d3s9db1 b.1.2.1 (B:12-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncanttrsfcdltde
wrstheayvtvlegfsgnttlfscshnfwlaidmsfep

Sequence, based on observed residues (ATOM records):

>d3s9db1 b.1.2.1 (B:12-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncanttrsfcdltde
wrstheayvtvlegfsttlfscshnfwlaidmsfep

Timeline for d3s9db1:

• d3s9db1 first appeared in SCOPe 2.03
  
• d3s9db1 appears in SCOPe 2.05
  
• d3s9db1 appears in the current release, SCOPe 2.08