SCOPe 2.05: Domain d3s9da_: 3s9d A:

Lineage for d3s9da_ (3s9d A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-alpha 2a [47314] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47315] (7 PDB entries)

8. Domain d3s9da_: 3s9d A: [200600]
   Other proteins in same PDB: d3s9db1, d3s9db2, d3s9dd1, d3s9dd2
   automated match to d3s9dc_
   complexed with cl

Details for d3s9da_

PDB Entry: 3s9d, 2 Å

PDB Description: binary complex between IFNa2 and IFNAR2

PDB Compounds: (A:) Interferon alpha-2

SCOPe Domain Sequences for d3s9da_:

Sequence, based on SEQRES records:

>d3s9da_ a.26.1.3 (A:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
slgsrrtlmllaqmrrislfsclkdrhdfgfpqeefgnqfqkaetipvlaamiaqifnlf
stkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavrkyfqrit
lylkekkyspcawevvraeimrsfslstn

Sequence, based on observed residues (ATOM records):

>d3s9da_ a.26.1.3 (A:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
slgsrrtlmllaqmrrislfsclkdrhdfgfpqeefetipvlaamiaqifnlfstkdssa
awdetlldkfytelyqqlndleacdsilavrkyfqritlylkekkyspcawevvraeimr
sfslstn

Timeline for d3s9da_:

• d3s9da_ first appeared in SCOPe 2.03
  
• d3s9da_ appears in SCOPe 2.04
  
• d3s9da_ appears in SCOPe 2.06
  
• d3s9da_ appears in the current release, SCOPe 2.08