Lineage for d3s8fb2 (3s8f B:41-168)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528012Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 1528013Protein Cytochrome c oxidase [49544] (4 species)
  7. 1528083Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (29 PDB entries)
  8. 1528085Domain d3s8fb2: 3s8f B:41-168 [200597]
    Other proteins in same PDB: d3s8fa_, d3s8fb1, d3s8fc_
    automated match to d1ehkb1
    complexed with cu, cua, has, hem, olc, per

Details for d3s8fb2

PDB Entry: 3s8f (more details), 1.8 Å

PDB Description: 1.8 a structure of ba3 cytochrome c oxidase from thermus thermophilus in lipid environment
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3s8fb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s8fb2 b.6.1.2 (B:41-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
tagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqg
aeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnm
fgtivvke

SCOPe Domain Coordinates for d3s8fb2:

Click to download the PDB-style file with coordinates for d3s8fb2.
(The format of our PDB-style files is described here.)

Timeline for d3s8fb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s8fb1