Lineage for d3s8fa_ (3s8f A:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1698770Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 1698771Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 1698772Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 1698790Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)
  7. 1698791Species Thermus thermophilus [TaxId:274] [81437] (25 PDB entries)
  8. 1698793Domain d3s8fa_: 3s8f A: [196274]
    Other proteins in same PDB: d3s8fb1, d3s8fb2, d3s8fc_
    automated match to d1xmea_
    complexed with cu, cua, has, hem, olc, per

Details for d3s8fa_

PDB Entry: 3s8f (more details), 1.8 Å

PDB Description: 1.8 a structure of ba3 cytochrome c oxidase from thermus thermophilus in lipid environment
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3s8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s8fa_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
srvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqg
ltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllane
atvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavv
fwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiy
tilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavp
slmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnas
ftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlw
flgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiygl
fsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvq
lfghlnpvpgwrlw

SCOPe Domain Coordinates for d3s8fa_:

Click to download the PDB-style file with coordinates for d3s8fa_.
(The format of our PDB-style files is described here.)

Timeline for d3s8fa_: