![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
![]() | Protein D2 core SNRNP protein [50186] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50187] (5 PDB entries) |
![]() | Domain d3s6nb_: 3s6n B: [200590] Other proteins in same PDB: d3s6na_, d3s6nf_, d3s6ng_ automated match to d1b34b_ protein/RNA complex |
PDB Entry: 3s6n (more details), 2.5 Å
SCOPe Domain Sequences for d3s6nb_:
Sequence, based on SEQRES records: (download)
>d3s6nb_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} efntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevpksgk gkkkskpvnkdryiskmflrgdsvivvlrnplia
>d3s6nb_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} efntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevnkdry iskmflrgdsvivvlrnplia
Timeline for d3s6nb_: