Lineage for d3s6nb_ (3s6n B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1786640Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1786845Protein D2 core SNRNP protein [50186] (2 species)
  7. 1786846Species Human (Homo sapiens) [TaxId:9606] [50187] (5 PDB entries)
  8. 1786848Domain d3s6nb_: 3s6n B: [200590]
    Other proteins in same PDB: d3s6na_, d3s6nf_, d3s6ng_
    automated match to d1b34b_
    protein/RNA complex

Details for d3s6nb_

PDB Entry: 3s6n (more details), 2.5 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2 in complex with smd1/d2/f/e/g from human
PDB Compounds: (B:) Small nuclear ribonucleoprotein Sm D2

SCOPe Domain Sequences for d3s6nb_:

Sequence, based on SEQRES records: (download)

>d3s6nb_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
efntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevpksgk
gkkkskpvnkdryiskmflrgdsvivvlrnplia

Sequence, based on observed residues (ATOM records): (download)

>d3s6nb_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
efntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevnkdry
iskmflrgdsvivvlrnplia

SCOPe Domain Coordinates for d3s6nb_:

Click to download the PDB-style file with coordinates for d3s6nb_.
(The format of our PDB-style files is described here.)

Timeline for d3s6nb_: