SCOPe 2.07: Domain d3puwe1: 3puw E:1-370

Lineage for d3puwe1 (3puw E:1-370)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein automated matches [190140] (38 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189211] (10 PDB entries)

8. Domain d3puwe1: 3puw E:1-370 [200240]
   Other proteins in same PDB: d3puwa1, d3puwa2, d3puwa3, d3puwb1, d3puwb2, d3puwe2, d3puwf1, d3puwf2, d3puwg_
   automated match to d3puve_
   complexed with adp, alf, mal, mg, pgv, umq

Details for d3puwe1

PDB Entry: 3puw, 2.3 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4

PDB Compounds: (E:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3puwe1:

Sequence; same for both SEQRES and ATOM records:

>d3puwe1 c.94.1.1 (E:1-370) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

Timeline for d3puwe1:

• d3puwe1 first appeared in SCOPe 2.03, called d3puwe_
  
• d3puwe1 appears in SCOPe 2.06
  
• d3puwe1 appears in the current release, SCOPe 2.08