Lineage for d3puwb2 (3puw B:236-369)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2400579Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2400663Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 2400683Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 2400684Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 2400688Domain d3puwb2: 3puw B:236-369 [200239]
    Other proteins in same PDB: d3puwa1, d3puwa3, d3puwb1, d3puwe1, d3puwe2, d3puwf1, d3puwf2, d3puwg_
    automated match to d1q12a1
    complexed with adp, alf, mal, mg, pgv, umq

Details for d3puwb2

PDB Entry: 3puw (more details), 2.3 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
PDB Compounds: (B:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d3puwb2:

Sequence, based on SEQRES records: (download)

>d3puwb2 b.40.6.3 (B:236-369) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkep

Sequence, based on observed residues (ATOM records): (download)

>d3puwb2 b.40.6.3 (B:236-369) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvtataidqvqvelpmpnrqqvwlpvenmslgirpehllpsdiadvilegevq
vveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgtacrrl
hkep

SCOPe Domain Coordinates for d3puwb2:

Click to download the PDB-style file with coordinates for d3puwb2.
(The format of our PDB-style files is described here.)

Timeline for d3puwb2: