SCOPe 2.07: Domain d3puwb2: 3puw B:236-369

Lineage for d3puwb2 (3puw B:236-369)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (4 families)

5. Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
   probably stems out from the biMOP domain

6. Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)

7. Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)

8. Domain d3puwb2: 3puw B:236-369 [200239]
   Other proteins in same PDB: d3puwa1, d3puwa3, d3puwb1, d3puwe1, d3puwe2, d3puwf1, d3puwf2, d3puwg_
   automated match to d1q12a1
   complexed with adp, alf, mal, mg, pgv, umq

Details for d3puwb2

PDB Entry: 3puw, 2.3 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4

PDB Compounds: (B:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d3puwb2:

Sequence, based on SEQRES records:

>d3puwb2 b.40.6.3 (B:236-369) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkep

Sequence, based on observed residues (ATOM records):

>d3puwb2 b.40.6.3 (B:236-369) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvtataidqvqvelpmpnrqqvwlpvenmslgirpehllpsdiadvilegevq
vveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlfredgtacrrl
hkep

Timeline for d3puwb2:

• d3puwb2 first appeared in SCOPe 2.03
  
• d3puwb2 appears in SCOPe 2.06
  
• d3puwb2 appears in the current release, SCOPe 2.08