Lineage for d3puwe1 (3puw E:1-370)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2163017Protein automated matches [190140] (30 species)
    not a true protein
  7. 2163063Species Escherichia coli K-12 [TaxId:83333] [189211] (10 PDB entries)
  8. 2163088Domain d3puwe1: 3puw E:1-370 [200240]
    Other proteins in same PDB: d3puwa1, d3puwa2, d3puwa3, d3puwb1, d3puwb2, d3puwe2, d3puwf1, d3puwf2, d3puwg_
    automated match to d3puve_
    complexed with adp, alf, mal, mg, pgv, umq

Details for d3puwe1

PDB Entry: 3puw (more details), 2.3 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
PDB Compounds: (E:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3puwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puwe1 c.94.1.1 (E:1-370) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

SCOPe Domain Coordinates for d3puwe1:

Click to download the PDB-style file with coordinates for d3puwe1.
(The format of our PDB-style files is described here.)

Timeline for d3puwe1: