Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
Protein automated matches [226841] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries) |
Domain d3owen2: 3owe N:116-233 [200178] Other proteins in same PDB: d3owea_, d3oweb1, d3oweb3, d3owec_, d3owed1, d3owed3, d3owee_, d3owef1, d3owef3, d3oweg_, d3oweh1, d3oweh3, d3owei_, d3owej1, d3owej3, d3owek_, d3owel1, d3owel3, d3owem_, d3owen1, d3owen3, d3oweo_, d3owep1, d3owep3 automated match to d1d5zc2 mutant |
PDB Entry: 3owe (more details), 2.6 Å
SCOPe Domain Sequences for d3owen2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3owen2 d.15.6.0 (N:116-233) automated matches {Staphylococcus aureus [TaxId: 1280]} nssenerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsa fesgyikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
Timeline for d3owen2:
View in 3D Domains from other chains: (mouse over for more information) d3owea_, d3oweb1, d3oweb2, d3oweb3, d3owec_, d3owed1, d3owed2, d3owed3, d3owee_, d3owef1, d3owef2, d3owef3, d3oweg_, d3oweh1, d3oweh2, d3oweh3, d3owei_, d3owej1, d3owej2, d3owej3, d3owek_, d3owel1, d3owel2, d3owel3, d3owem_, d3oweo_, d3owep1, d3owep2, d3owep3 |