Lineage for d3owen2 (3owe N:116-233)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934586Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2934587Protein automated matches [226841] (6 species)
    not a true protein
  7. 2934588Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries)
  8. 2934601Domain d3owen2: 3owe N:116-233 [200178]
    Other proteins in same PDB: d3owea_, d3oweb1, d3oweb3, d3owec_, d3owed1, d3owed3, d3owee_, d3owef1, d3owef3, d3oweg_, d3oweh1, d3oweh3, d3owei_, d3owej1, d3owej3, d3owek_, d3owel1, d3owel3, d3owem_, d3owen1, d3owen3, d3oweo_, d3owep1, d3owep3
    automated match to d1d5zc2
    mutant

Details for d3owen2

PDB Entry: 3owe (more details), 2.6 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain
PDB Compounds: (N:) Enterotoxin SEG

SCOPe Domain Sequences for d3owen2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3owen2 d.15.6.0 (N:116-233) automated matches {Staphylococcus aureus [TaxId: 1280]}
nssenerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsa
fesgyikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth

SCOPe Domain Coordinates for d3owen2:

Click to download the PDB-style file with coordinates for d3owen2.
(The format of our PDB-style files is described here.)

Timeline for d3owen2: