PDB entry 3owe

View 3owe on RCSB PDB site
Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain
Class: immune system
Keywords: T-CELL RECEPTOR V BETA DOMAIN, COMPLEX STRUCTURE, IgG domains, B grasp, virulence factors, IMMUNE SYSTEM
Deposited on 2010-09-17, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.211
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTY6 (Start-111)
      • engineered mutation (18)
      • engineered mutation (25)
      • engineered mutation (53)
      • engineered mutation (55)
      • engineered mutation (66)
      • engineered mutation (72)
      • engineered mutation (74)
      • engineered mutation (80-81)
      • engineered mutation (87)
      • engineered mutation (96)
      • engineered mutation (100)
      • engineered mutation (104)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d3owea_
  • Chain 'B':
    Compound: Enterotoxin SEG
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EMB6 (1-233)
      • expression tag (0)
    Domains in SCOPe 2.07: d3oweb1, d3oweb2, d3oweb3
  • Chain 'C':
    Compound: Beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTY6 (Start-111)
      • engineered mutation (18)
      • engineered mutation (25)
      • engineered mutation (53)
      • engineered mutation (55)
      • engineered mutation (66)
      • engineered mutation (72)
      • engineered mutation (74)
      • engineered mutation (80-81)
      • engineered mutation (87)
      • engineered mutation (96)
      • engineered mutation (100)
      • engineered mutation (104)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d3owec_
  • Chain 'D':
    Compound: Enterotoxin SEG
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EMB6 (1-233)
      • expression tag (0)
    Domains in SCOPe 2.07: d3owed1, d3owed2, d3owed3
  • Chain 'E':
    Compound: Beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTY6 (Start-111)
      • engineered mutation (18)
      • engineered mutation (25)
      • engineered mutation (53)
      • engineered mutation (55)
      • engineered mutation (66)
      • engineered mutation (72)
      • engineered mutation (74)
      • engineered mutation (80-81)
      • engineered mutation (87)
      • engineered mutation (96)
      • engineered mutation (100)
      • engineered mutation (104)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d3owee_
  • Chain 'F':
    Compound: Enterotoxin SEG
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EMB6 (1-233)
      • expression tag (0)
    Domains in SCOPe 2.07: d3owef1, d3owef2, d3owef3
  • Chain 'G':
    Compound: Beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTY6 (Start-111)
      • engineered mutation (18)
      • engineered mutation (25)
      • engineered mutation (53)
      • engineered mutation (55)
      • engineered mutation (66)
      • engineered mutation (72)
      • engineered mutation (74)
      • engineered mutation (80-81)
      • engineered mutation (87)
      • engineered mutation (96)
      • engineered mutation (100)
      • engineered mutation (104)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d3oweg_
  • Chain 'H':
    Compound: Enterotoxin SEG
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EMB6 (1-233)
      • expression tag (0)
    Domains in SCOPe 2.07: d3oweh1, d3oweh2, d3oweh3
  • Chain 'I':
    Compound: Beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTY6 (Start-111)
      • engineered mutation (18)
      • engineered mutation (25)
      • engineered mutation (53)
      • engineered mutation (55)
      • engineered mutation (66)
      • engineered mutation (72)
      • engineered mutation (74)
      • engineered mutation (80-81)
      • engineered mutation (87)
      • engineered mutation (96)
      • engineered mutation (100)
      • engineered mutation (104)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d3owei_
  • Chain 'J':
    Compound: Enterotoxin SEG
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EMB6 (1-233)
      • expression tag (0)
    Domains in SCOPe 2.07: d3owej1, d3owej2, d3owej3
  • Chain 'K':
    Compound: Beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTY6 (Start-111)
      • engineered mutation (18)
      • engineered mutation (25)
      • engineered mutation (53)
      • engineered mutation (55)
      • engineered mutation (66)
      • engineered mutation (72)
      • engineered mutation (74)
      • engineered mutation (80-81)
      • engineered mutation (87)
      • engineered mutation (96)
      • engineered mutation (100)
      • engineered mutation (104)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d3owek_
  • Chain 'L':
    Compound: Enterotoxin SEG
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EMB6 (1-233)
      • expression tag (0)
    Domains in SCOPe 2.07: d3owel1, d3owel2, d3owel3
  • Chain 'M':
    Compound: Beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTY6 (Start-111)
      • engineered mutation (18)
      • engineered mutation (25)
      • engineered mutation (53)
      • engineered mutation (55)
      • engineered mutation (66)
      • engineered mutation (72)
      • engineered mutation (74)
      • engineered mutation (80-81)
      • engineered mutation (87)
      • engineered mutation (96)
      • engineered mutation (100)
      • engineered mutation (104)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d3owem_
  • Chain 'N':
    Compound: Enterotoxin SEG
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EMB6 (1-233)
      • expression tag (0)
    Domains in SCOPe 2.07: d3owen1, d3owen2, d3owen3
  • Chain 'O':
    Compound: Beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTY6 (Start-111)
      • engineered mutation (18)
      • engineered mutation (25)
      • engineered mutation (53)
      • engineered mutation (55)
      • engineered mutation (66)
      • engineered mutation (72)
      • engineered mutation (74)
      • engineered mutation (80-81)
      • engineered mutation (87)
      • engineered mutation (96)
      • engineered mutation (100)
      • engineered mutation (104)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d3oweo_
  • Chain 'P':
    Compound: Enterotoxin SEG
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0EMB6 (1-233)
      • expression tag (0)
    Domains in SCOPe 2.07: d3owep1, d3owep2, d3owep3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oweA (A:)
    aaeaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekg
    dipdgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweA (A:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
    dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3oweB (B:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltfnsse
    nerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesg
    yikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweB (B:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksefggccmyggltfnssenrdkli
    tvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgyikftek
    nntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3oweC (C:)
    aaeaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekg
    dipdgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweC (C:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
    dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3oweD (D:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltfnsse
    nerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesg
    yikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweD (D:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksefggccmyggltfnssenrdkli
    tvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgyikftek
    nntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3oweE (E:)
    aaeaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekg
    dipdgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweE (E:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
    dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3oweF (F:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltfnsse
    nerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesg
    yikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweF (F:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksefggccmyggltfnssenrdkli
    tvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgyikftek
    nntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3oweG (G:)
    aaeaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekg
    dipdgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweG (G:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
    dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3oweH (H:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltfnsse
    nerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesg
    yikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweH (H:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksefggccmyggltfnssenrdkli
    tvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgyikftek
    nntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3oweI (I:)
    aaeaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekg
    dipdgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweI (I:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
    dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3oweJ (J:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltfnsse
    nerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesg
    yikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweJ (J:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksefggccmyggltfnssenrdkli
    tvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgyikftek
    nntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3oweK (K:)
    aaeaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekg
    dipdgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweK (K:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
    dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3oweL (L:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltfnsse
    nerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesg
    yikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweL (L:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksefggccmyggltfnssenerdkl
    itvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgyikfte
    knntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3oweM (M:)
    aaeaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekg
    dipdgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweM (M:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
    dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3oweN (N:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltfnsse
    nerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesg
    yikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweN (N:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksefggccmyggltfnssenerdkl
    itvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgyikfte
    knntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3oweO (O:)
    aaeaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekg
    dipdgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweO (O:)
    aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
    dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3oweP (P:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltfnsse
    nerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesg
    yikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oweP (P:)
    aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
    nevktelentelannykgkkvdifgvpyfytciipksefggccmyggltfnssenerdkl
    itvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsafesgyikfte
    knntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth