| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
| Domain d3owec_: 3owe C: [192766] Other proteins in same PDB: d3oweb1, d3oweb2, d3oweb3, d3owed1, d3owed2, d3owed3, d3owef1, d3owef2, d3owef3, d3oweh1, d3oweh2, d3oweh3, d3owej1, d3owej2, d3owej3, d3owel1, d3owel2, d3owel3, d3owen1, d3owen2, d3owen3, d3owep1, d3owep2, d3owep3 automated match to d2apba_ mutant |
PDB Entry: 3owe (more details), 2.6 Å
SCOPe Domain Sequences for d3owec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3owec_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
Timeline for d3owec_:
View in 3DDomains from other chains: (mouse over for more information) d3owea_, d3oweb1, d3oweb2, d3oweb3, d3owed1, d3owed2, d3owed3, d3owee_, d3owef1, d3owef2, d3owef3, d3oweg_, d3oweh1, d3oweh2, d3oweh3, d3owei_, d3owej1, d3owej2, d3owej3, d3owek_, d3owel1, d3owel2, d3owel3, d3owem_, d3owen1, d3owen2, d3owen3, d3oweo_, d3owep1, d3owep2, d3owep3 |