Lineage for d3ovub1 (3ovu B:86-227)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2039984Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2039985Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 2040008Protein automated matches [191246] (3 species)
    not a true protein
  7. 2040026Species Staphylococcus aureus [TaxId:282459] [226200] (2 PDB entries)
  8. 2040027Domain d3ovub1: 3ovu B:86-227 [200163]
    Other proteins in same PDB: d3ovua_, d3ovub2, d3ovuc_
    automated match to d2h3ka1
    complexed with hem

Details for d3ovub1

PDB Entry: 3ovu (more details), 2.83 Å

PDB Description: Crystal Structure of Human Alpha-Haemoglobin Complexed with AHSP and the First NEAT Domain of IsdH from Staphylococcus aureus
PDB Compounds: (B:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d3ovub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ovub1 b.1.28.1 (B:86-227) automated matches {Staphylococcus aureus [TaxId: 282459]}
adeslkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkae
veldintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqid
dgeetnydytklvfakpiyndp

SCOPe Domain Coordinates for d3ovub1:

Click to download the PDB-style file with coordinates for d3ovub1.
(The format of our PDB-style files is described here.)

Timeline for d3ovub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ovub2