| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) ![]() |
| Family b.1.28.1: NEAT domain [158912] (4 proteins) Pfam PF05031; iron transport-associated domain |
| Protein automated matches [191246] (3 species) not a true protein |
| Species Staphylococcus aureus [TaxId:282459] [226200] (2 PDB entries) |
| Domain d3ovub1: 3ovu B:86-227 [200163] Other proteins in same PDB: d3ovua_, d3ovub2, d3ovuc_ automated match to d2h3ka1 complexed with hem |
PDB Entry: 3ovu (more details), 2.83 Å
SCOPe Domain Sequences for d3ovub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ovub1 b.1.28.1 (B:86-227) automated matches {Staphylococcus aureus [TaxId: 282459]}
adeslkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkae
veldintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqid
dgeetnydytklvfakpiyndp
Timeline for d3ovub1: