SCOPe 2.08: Domain d3ovub1: 3ovu B:86-227

Lineage for d3ovub1 (3ovu B:86-227)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.1: NEAT domain [158912] (4 proteins)
   Pfam PF05031; iron transport-associated domain

6. Protein automated matches [191246] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282459] [226200] (2 PDB entries)

8. Domain d3ovub1: 3ovu B:86-227 [200163]
   Other proteins in same PDB: d3ovua_, d3ovub2, d3ovuc_
   automated match to d2h3ka1
   complexed with hem

Details for d3ovub1

PDB Entry: 3ovu, 2.83 Å

PDB Description: Crystal Structure of Human Alpha-Haemoglobin Complexed with AHSP and the First NEAT Domain of IsdH from Staphylococcus aureus

PDB Compounds: (B:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d3ovub1:

Sequence; same for both SEQRES and ATOM records:

>d3ovub1 b.1.28.1 (B:86-227) automated matches {Staphylococcus aureus [TaxId: 282459]}
adeslkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkae
veldintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqid
dgeetnydytklvfakpiyndp

Timeline for d3ovub1:

• d3ovub1 first appeared in SCOPe 2.03, called d3ovub_
  
• d3ovub1 appears in SCOPe 2.07