SCOPe 2.06: Domain d3ovua_: 3ovu A:

Lineage for d3ovua_ (3ovu A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.11: Alpha-hemoglobin stabilizing protein AHSP [109751] (1 family)
   the bundle twist angle is close to zero (small positive value); similar to the RRF alpha-helical bundle, (55194)
   automatically mapped to Pfam PF09236

5. Family a.7.11.1: Alpha-hemoglobin stabilizing protein AHSP [109752] (1 protein)
   this is a repeat family; one repeat unit is 1w0a A: found in domain

6. Protein Alpha-hemoglobin stabilizing protein AHSP [109753] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109754] (7 PDB entries)
   Uniprot Q9NZD4 1-94

8. Domain d3ovua_: 3ovu A: [196163]
   Other proteins in same PDB: d3ovub1, d3ovub2, d3ovuc_
   automated match to d1xzya_
   complexed with hem

Details for d3ovua_

PDB Entry: 3ovu, 2.83 Å

PDB Description: Crystal Structure of Human Alpha-Haemoglobin Complexed with AHSP and the First NEAT Domain of IsdH from Staphylococcus aureus

PDB Compounds: (A:) Alpha-hemoglobin-stabilizing protein

SCOPe Domain Sequences for d3ovua_:

Sequence; same for both SEQRES and ATOM records:

>d3ovua_ a.7.11.1 (A:) Alpha-hemoglobin stabilizing protein AHSP {Human (Homo sapiens) [TaxId: 9606]}
lkankdlisaglkefsvllnqqvfndplvseedmvtvvedwmnfyinyyrqqvtgepqer
dkalqelrqelntlanpflakyrdflks

Timeline for d3ovua_:

• d3ovua_ first appeared in SCOPe 2.02
  
• d3ovua_ appears in SCOPe 2.05
  
• d3ovua_ appears in SCOPe 2.07
  
• d3ovua_ appears in the current release, SCOPe 2.08