| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins) C-terminal domain is all-alpha |
| Protein Alpha chain [55095] (3 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (11 PDB entries) |
| Domain d3m2vd1: 3m2v D:2-269 [199797] Other proteins in same PDB: d3m2va2, d3m2vb1, d3m2vb2, d3m2vc_, d3m2vd2, d3m2ve1, d3m2ve2, d3m2vf_ automated match to d1hbna2 complexed with act, com, edo, f43, mg, tp7, xp8, zn |
PDB Entry: 3m2v (more details), 1.8 Å
SCOPe Domain Sequences for d3m2vd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m2vd1 d.58.31.2 (D:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv
Timeline for d3m2vd1: