SCOPe 2.08: Domain d3m2vd1: 3m2v D:2-269

Lineage for d3m2vd1 (3m2v D:2-269)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Alpha chain [55095] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (11 PDB entries)

8. Domain d3m2vd1: 3m2v D:2-269 [199797]
   Other proteins in same PDB: d3m2va2, d3m2vb1, d3m2vb2, d3m2vc_, d3m2vd2, d3m2ve1, d3m2ve2, d3m2vf_
   automated match to d1hbna2
   complexed with act, com, edo, f43, mg, tp7, xp8, zn

Details for d3m2vd1

PDB Entry: 3m2v, 1.8 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues

PDB Compounds: (D:) Methyl-coenzyme M reductase I subunit alpha

SCOPe Domain Sequences for d3m2vd1:

Sequence; same for both SEQRES and ATOM records:

>d3m2vd1 d.58.31.2 (D:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

Timeline for d3m2vd1:

• d3m2vd1 first appeared in SCOPe 2.03
  
• d3m2vd1 appears in SCOPe 2.07