Lineage for d3m2va1 (3m2v A:2-269)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197885Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2197936Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
    C-terminal domain is all-alpha
  6. 2197937Protein Alpha chain [55095] (3 species)
  7. 2197938Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (11 PDB entries)
  8. 2197957Domain d3m2va1: 3m2v A:2-269 [199793]
    Other proteins in same PDB: d3m2va2, d3m2vb1, d3m2vb2, d3m2vc_, d3m2vd2, d3m2ve1, d3m2ve2, d3m2vf_
    automated match to d1hbna2
    complexed with act, com, edo, f43, mg, tp7, xp8, zn

Details for d3m2va1

PDB Entry: 3m2v (more details), 1.8 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues
PDB Compounds: (A:) Methyl-coenzyme M reductase I subunit alpha

SCOPe Domain Sequences for d3m2va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m2va1 d.58.31.2 (A:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOPe Domain Coordinates for d3m2va1:

Click to download the PDB-style file with coordinates for d3m2va1.
(The format of our PDB-style files is described here.)

Timeline for d3m2va1: