Lineage for d2jell1 (2jel L:1-108)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219814Species Fab JE142 (mouse), kappa L chain [48789] (1 PDB entry)
  8. 219816Domain d2jell1: 2jel L:1-108 [19978]
    Other proteins in same PDB: d2jelh2, d2jell2, d2jelp_

Details for d2jell1

PDB Entry: 2jel (more details), 2.5 Å

PDB Description: jel42 fab/hpr complex

SCOP Domain Sequences for d2jell1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jell1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab JE142 (mouse), kappa L chain}
dvlmtqtplslpvslgdqasiscrssqsivhgngntylewylqkpgqspklliykisnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr

SCOP Domain Coordinates for d2jell1:

Click to download the PDB-style file with coordinates for d2jell1.
(The format of our PDB-style files is described here.)

Timeline for d2jell1: