SCOP 1.63: Domain d2jell2: 2jel L:109-212

Lineage for d2jell2 (2jel L:109-212)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab JE142 (mouse), kappa L chain [49009] (1 PDB entry)

8. Domain d2jell2: 2jel L:109-212 [21034]
   Other proteins in same PDB: d2jelh1, d2jell1, d2jelp_

Details for d2jell2

PDB Entry: 2jel, 2.5 Å

PDB Description: jel42 fab/hpr complex

SCOP Domain Sequences for d2jell2:

Sequence; same for both SEQRES and ATOM records:

>d2jell2 b.1.1.2 (L:109-212) Immunoglobulin (constant domains of L and H chains) {Fab JE142 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkigdgarqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktsdspivksfnrn

Timeline for d2jell2:

• d2jell2 first appeared (with stable ids) in SCOP 1.55
  
• d2jell2 appears in SCOP 1.61
  
• d2jell2 appears in SCOP 1.65
  
• d2jell2 appears in the current release, SCOPe 2.08