Lineage for d3kpsd2 (3kps D:118-206)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517073Protein T-cell antigen receptor [49125] (7 species)
  7. 1517074Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (20 PDB entries)
  8. 1517083Domain d3kpsd2: 3kps D:118-206 [199658]
    Other proteins in same PDB: d3kpsa1, d3kpsa2, d3kpsb_, d3kpsd1, d3kpse1
    automated match to d1mi5d2

Details for d3kpsd2

PDB Entry: 3kps (more details), 2.7 Å

PDB Description: crystal structure of the lc13 tcr in complex with hla b*4405 bound to eeylqafty a self peptide from the abcd3 protein
PDB Compounds: (D:) LC13 TCR alpha chain

SCOPe Domain Sequences for d3kpsd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kpsd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3kpsd2:

Click to download the PDB-style file with coordinates for d3kpsd2.
(The format of our PDB-style files is described here.)

Timeline for d3kpsd2: