![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (7 species) |
![]() | Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (20 PDB entries) |
![]() | Domain d3kpsd2: 3kps D:118-206 [199658] Other proteins in same PDB: d3kpsa1, d3kpsa2, d3kpsb_, d3kpsd1, d3kpse1 automated match to d1mi5d2 |
PDB Entry: 3kps (more details), 2.7 Å
SCOPe Domain Sequences for d3kpsd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kpsd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
Timeline for d3kpsd2: