SCOPe 2.08: Domain d3kpsd2: 3kps D:118-206

Lineage for d3kpsd2 (3kps D:118-206)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)

8. Domain d3kpsd2: 3kps D:118-206 [199658]
   Other proteins in same PDB: d3kpsa1, d3kpsa2, d3kpsb_, d3kpsd1, d3kpse1
   automated match to d1mi5d2
   missing some secondary structures that made up less than one-third of the common domain

Details for d3kpsd2

PDB Entry: 3kps, 2.7 Å

PDB Description: crystal structure of the lc13 tcr in complex with hla b*4405 bound to eeylqafty a self peptide from the abcd3 protein

PDB Compounds: (D:) LC13 TCR alpha chain

SCOPe Domain Sequences for d3kpsd2:

Sequence; same for both SEQRES and ATOM records:

>d3kpsd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d3kpsd2:

• d3kpsd2 first appeared in SCOPe 2.03
  
• d3kpsd2 appears in SCOPe 2.07