Lineage for d3i9sc_ (3i9s C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2210086Species Vibrio cholerae [TaxId:666] [188612] (13 PDB entries)
  8. 2210089Domain d3i9sc_: 3i9s C: [199545]
    Other proteins in same PDB: d3i9sb2
    automated match to d3i9sd_
    complexed with cl, so4

Details for d3i9sc_

PDB Entry: 3i9s (more details), 2.2 Å

PDB Description: Structure from the mobile metagenome of V.cholerae. Integron cassette protein VCH_CASS6
PDB Compounds: (C:) Integron cassette protein

SCOPe Domain Sequences for d3i9sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i9sc_ d.108.1.0 (C:) automated matches {Vibrio cholerae [TaxId: 666]}
msveikrvdkhhcldlvgifieleryyfgdkaaseqdlanylshqvfsehsgvkviaave
hdkvlgfatytimfpapklsgqmymkdlfvsssargkgiglqlmkhlatiaithncqrld
wtaestnptagkfyksigaslirekeyyrfegnglnklaks

SCOPe Domain Coordinates for d3i9sc_:

Click to download the PDB-style file with coordinates for d3i9sc_.
(The format of our PDB-style files is described here.)

Timeline for d3i9sc_: