SCOPe 2.06: Domain d3i9sb1: 3i9s B:1-161

Lineage for d3i9sb1 (3i9s B:1-161)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [188612] (13 PDB entries)

8. Domain d3i9sb1: 3i9s B:1-161 [199544]
   Other proteins in same PDB: d3i9sb2
   automated match to d3i9sd_
   complexed with cl, so4

Details for d3i9sb1

PDB Entry: 3i9s, 2.2 Å

PDB Description: Structure from the mobile metagenome of V.cholerae. Integron cassette protein VCH_CASS6

PDB Compounds: (B:) Integron cassette protein

SCOPe Domain Sequences for d3i9sb1:

Sequence; same for both SEQRES and ATOM records:

>d3i9sb1 d.108.1.0 (B:1-161) automated matches {Vibrio cholerae [TaxId: 666]}
msveikrvdkhhcldlvgifieleryyfgdkaaseqdlanylshqvfsehsgvkviaave
hdkvlgfatytimfpapklsgqmymkdlfvsssargkgiglqlmkhlatiaithncqrld
wtaestnptagkfyksigaslirekeyyrfegnglnklaks

Timeline for d3i9sb1:

• d3i9sb1 first appeared in SCOPe 2.03, called d3i9sb_
  
• d3i9sb1 was called d3i9sb_ in SCOPe 2.05
  
• d3i9sb1 appears in SCOPe 2.07
  
• d3i9sb1 appears in the current release, SCOPe 2.08