Lineage for d3fh0a_ (3fh0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1842519Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 1842520Protein automated matches [190116] (18 species)
    not a true protein
  7. 1842559Species Klebsiella pneumoniae [TaxId:272620] [193623] (2 PDB entries)
  8. 1842562Domain d3fh0a_: 3fh0 A: [199404]
    automated match to d3fh0b_
    complexed with adp, edo

Details for d3fh0a_

PDB Entry: 3fh0 (more details), 2.15 Å

PDB Description: Crystal structure of putative universal stress protein KPN_01444 - ATPase
PDB Compounds: (A:) putative universal stress protein KPN_01444

SCOPe Domain Sequences for d3fh0a_:

Sequence, based on SEQRES records: (download)

>d3fh0a_ c.26.2.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
snamilvpidisdkefteriishveseariddaevhfltvipslpyyaslgmaytaelpg
mdelregsetqlkeiakkfsipedrmhfhvaegspkdkilalakslpadlviiashrpdi
ttyllgsnaaavvrhaecsvlvvr

Sequence, based on observed residues (ATOM records): (download)

>d3fh0a_ c.26.2.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
snamilvpidisderiishveseariddaevhfltvipslgmdelregsetqlkeiakkf
sipedrmhfhvaegspkdkilalakslpadlviiashrpdittyllgsnaaavvrhaecs
vlvvr

SCOPe Domain Coordinates for d3fh0a_:

Click to download the PDB-style file with coordinates for d3fh0a_.
(The format of our PDB-style files is described here.)

Timeline for d3fh0a_: