| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
| Protein automated matches [190116] (28 species) not a true protein |
| Species Klebsiella pneumoniae [TaxId:272620] [193623] (2 PDB entries) |
| Domain d3fh0a1: 3fh0 A:1-141 [199404] Other proteins in same PDB: d3fh0a2, d3fh0b2 automated match to d3fh0b_ complexed with adp, edo |
PDB Entry: 3fh0 (more details), 2.15 Å
SCOPe Domain Sequences for d3fh0a1:
Sequence, based on SEQRES records: (download)
>d3fh0a1 c.26.2.0 (A:1-141) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
milvpidisdkefteriishveseariddaevhfltvipslpyyaslgmaytaelpgmde
lregsetqlkeiakkfsipedrmhfhvaegspkdkilalakslpadlviiashrpditty
llgsnaaavvrhaecsvlvvr
>d3fh0a1 c.26.2.0 (A:1-141) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
milvpidisderiishveseariddaevhfltvipslgmdelregsetqlkeiakkfsip
edrmhfhvaegspkdkilalakslpadlviiashrpdittyllgsnaaavvrhaecsvlv
vr
Timeline for d3fh0a1: