SCOPe 2.04: Domain d3fh0a_: 3fh0 A:

Lineage for d3fh0a_ (3fh0 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (16 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [193623] (2 PDB entries)

8. Domain d3fh0a_: 3fh0 A: [199404]
   automated match to d3fh0b_
   complexed with adp, edo

Details for d3fh0a_

PDB Entry: 3fh0, 2.15 Å

PDB Description: Crystal structure of putative universal stress protein KPN_01444 - ATPase

PDB Compounds: (A:) putative universal stress protein KPN_01444

SCOPe Domain Sequences for d3fh0a_:

Sequence, based on SEQRES records:

>d3fh0a_ c.26.2.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
snamilvpidisdkefteriishveseariddaevhfltvipslpyyaslgmaytaelpg
mdelregsetqlkeiakkfsipedrmhfhvaegspkdkilalakslpadlviiashrpdi
ttyllgsnaaavvrhaecsvlvvr

Sequence, based on observed residues (ATOM records):

>d3fh0a_ c.26.2.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
snamilvpidisderiishveseariddaevhfltvipslgmdelregsetqlkeiakkf
sipedrmhfhvaegspkdkilalakslpadlviiashrpdittyllgsnaaavvrhaecs
vlvvr

Timeline for d3fh0a_:

• d3fh0a_ first appeared in SCOPe 2.03
  
• d3fh0a_ appears in SCOPe 2.05
  
• d3fh0a_ appears in the current release, SCOPe 2.08, called d3fh0a1