SCOPe 2.06: Domain d3fh0a1: 3fh0 A:1-141

Lineage for d3fh0a1 (3fh0 A:1-141)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (24 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [193623] (2 PDB entries)

8. Domain d3fh0a1: 3fh0 A:1-141 [199404]
   Other proteins in same PDB: d3fh0a2, d3fh0b2
   automated match to d3fh0b_
   complexed with adp, edo

Details for d3fh0a1

PDB Entry: 3fh0, 2.15 Å

PDB Description: Crystal structure of putative universal stress protein KPN_01444 - ATPase

PDB Compounds: (A:) putative universal stress protein KPN_01444

SCOPe Domain Sequences for d3fh0a1:

Sequence, based on SEQRES records:

>d3fh0a1 c.26.2.0 (A:1-141) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
milvpidisdkefteriishveseariddaevhfltvipslpyyaslgmaytaelpgmde
lregsetqlkeiakkfsipedrmhfhvaegspkdkilalakslpadlviiashrpditty
llgsnaaavvrhaecsvlvvr

Sequence, based on observed residues (ATOM records):

>d3fh0a1 c.26.2.0 (A:1-141) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
milvpidisderiishveseariddaevhfltvipslgmdelregsetqlkeiakkfsip
edrmhfhvaegspkdkilalakslpadlviiashrpdittyllgsnaaavvrhaecsvlv
vr

Timeline for d3fh0a1:

• d3fh0a1 first appeared in SCOPe 2.03, called d3fh0a_
  
• d3fh0a1 was called d3fh0a_ in SCOPe 2.05
  
• d3fh0a1 appears in SCOPe 2.07
  
• d3fh0a1 appears in the current release, SCOPe 2.08