Lineage for d3ci5a2 (3ci5 A:147-375)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605420Protein automated matches [226905] (11 species)
    not a true protein
  7. 1605432Species Dictyostelium discoideum [225500] (2 PDB entries)
  8. 1605434Domain d3ci5a2: 3ci5 A:147-375 [199189]
    Other proteins in same PDB: d3ci5a1, d3ci5g_
    automated match to d1d4xa2
    complexed with atp, ca, gol, mg, so4

Details for d3ci5a2

PDB Entry: 3ci5 (more details), 1.7 Å

PDB Description: complex of phosphorylated dictyostelium discoideum actin with gelsolin
PDB Compounds: (A:) Major actin

SCOPe Domain Sequences for d3ci5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ci5a2 c.55.1.1 (A:147-375) automated matches {Dictyostelium discoideum}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeaemqtaasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf

SCOPe Domain Coordinates for d3ci5a2:

Click to download the PDB-style file with coordinates for d3ci5a2.
(The format of our PDB-style files is described here.)

Timeline for d3ci5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ci5a1
View in 3D
Domains from other chains:
(mouse over for more information)
d3ci5g_