| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein automated matches [226905] (13 species) not a true protein |
| Species Dictyostelium discoideum [225500] (2 PDB entries) |
| Domain d3ci5a2: 3ci5 A:147-375 [199189] Other proteins in same PDB: d3ci5a1, d3ci5g2, d3ci5g3 automated match to d1d4xa2 complexed with atp, ca, gol, mg, so4 |
PDB Entry: 3ci5 (more details), 1.7 Å
SCOPe Domain Sequences for d3ci5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ci5a2 c.55.1.1 (A:147-375) automated matches {Dictyostelium discoideum}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeaemqtaasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf
Timeline for d3ci5a2: