| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
| Protein automated matches [190218] (13 species) not a true protein |
| Species Burkholderia xenovorans [TaxId:266265] [226024] (6 PDB entries) |
| Domain d2yflc2: 2yfl C:180-459 [198745] Other proteins in same PDB: d2yfla1, d2yflb_, d2yflc1, d2yfld_, d2yfle1, d2yflf_, d2yflg1, d2yflh_, d2yfli1, d2yflj_, d2yflk1, d2yfll_ automated match to d1wqla2 complexed with dc4, fe2, fes |
PDB Entry: 2yfl (more details), 2.6 Å
SCOPe Domain Sequences for d2yflc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yflc2 d.129.3.0 (C:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnqirvwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqpfnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
Timeline for d2yflc2: