| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
| Protein automated matches [190223] (3 species) not a true protein |
| Species Burkholderia xenovorans [TaxId:266265] [189543] (7 PDB entries) |
| Domain d2yflh_: 2yfl H: [195348] Other proteins in same PDB: d2yfla1, d2yfla2, d2yflc1, d2yflc2, d2yfle1, d2yfle2, d2yflg1, d2yflg2, d2yfli1, d2yfli2, d2yflk1, d2yflk2 automated match to d2xsob_ complexed with dc4, fe2, fes |
PDB Entry: 2yfl (more details), 2.6 Å
SCOPe Domain Sequences for d2yflh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yflh_ d.17.4.4 (H:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
Timeline for d2yflh_: