SCOPe 2.03: Domain d2yflk1: 2yfl K:18-179

Lineage for d2yflk1 (2yfl K:18-179)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (8 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226023] (6 PDB entries)

8. Domain d2yflk1: 2yfl K:18-179 [198752]
   Other proteins in same PDB: d2yfla2, d2yflb_, d2yflc2, d2yfld_, d2yfle2, d2yflf_, d2yflg2, d2yflh_, d2yfli2, d2yflj_, d2yflk2, d2yfll_
   automated match to d1wqla1
   complexed with dc4, fe2, fes

Details for d2yflk1

PDB Entry: 2yfl, 2.6 Å

PDB Description: Crystal Structure of Biphenyl dioxygenase variant RR41 with 2-chloro dibenzofuran

PDB Compounds: (K:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2yflk1:

Sequence, based on SEQRES records:

>d2yflk1 b.33.1.0 (K:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records):

>d2yflk1 b.33.1.0 (K:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

Timeline for d2yflk1:

• d2yflk1 is new in SCOPe 2.03-stable
  
• d2yflk1 appears in SCOPe 2.04
  
• d2yflk1 appears in the current release, SCOPe 2.08