SCOPe 2.08: Domain d2yflc2: 2yfl C:180-459

Lineage for d2yflc2 (2yfl C:180-459)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)

8. Domain d2yflc2: 2yfl C:180-459 [198745]
   Other proteins in same PDB: d2yfla1, d2yflb_, d2yflc1, d2yfld_, d2yfle1, d2yflf_, d2yflg1, d2yflh_, d2yfli1, d2yflj_, d2yflk1, d2yfll_
   automated match to d1wqla2
   complexed with dc4, fe2, fes

Details for d2yflc2

PDB Entry: 2yfl, 2.6 Å

PDB Description: Crystal Structure of Biphenyl dioxygenase variant RR41 with 2-chloro dibenzofuran

PDB Compounds: (C:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2yflc2:

Sequence; same for both SEQRES and ATOM records:

>d2yflc2 d.129.3.0 (C:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnqirvwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqpfnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

Timeline for d2yflc2:

• d2yflc2 first appeared in SCOPe 2.03
  
• d2yflc2 appears in SCOPe 2.07