Lineage for d2yfle2 (2yfl E:180-459)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539012Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2539333Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2539334Protein automated matches [190218] (22 species)
    not a true protein
  7. 2539337Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)
  8. 2539406Domain d2yfle2: 2yfl E:180-459 [198747]
    Other proteins in same PDB: d2yfla1, d2yflb_, d2yflc1, d2yfld_, d2yfle1, d2yflf_, d2yflg1, d2yflh_, d2yfli1, d2yflj_, d2yflk1, d2yfll_
    automated match to d1wqla2
    complexed with dc4, fe2, fes

Details for d2yfle2

PDB Entry: 2yfl (more details), 2.6 Å

PDB Description: Crystal Structure of Biphenyl dioxygenase variant RR41 with 2-chloro dibenzofuran
PDB Compounds: (E:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2yfle2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfle2 d.129.3.0 (E:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpamnqirvwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqpfnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

SCOPe Domain Coordinates for d2yfle2:

Click to download the PDB-style file with coordinates for d2yfle2.
(The format of our PDB-style files is described here.)

Timeline for d2yfle2: