![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
![]() | Protein automated matches [190223] (5 species) not a true protein |
![]() | Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries) |
![]() | Domain d2yfld_: 2yfl D: [195352] Other proteins in same PDB: d2yfla1, d2yfla2, d2yflc1, d2yflc2, d2yfle1, d2yfle2, d2yflg1, d2yflg2, d2yfli1, d2yfli2, d2yflk1, d2yflk2 automated match to d2xsob_ complexed with dc4, fe2, fes |
PDB Entry: 2yfl (more details), 2.6 Å
SCOPe Domain Sequences for d2yfld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yfld_ d.17.4.4 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]} fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
Timeline for d2yfld_: