Lineage for d2xrxe2 (2xrx E:180-459)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582438Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2582439Protein automated matches [190218] (22 species)
    not a true protein
  7. 2582442Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)
  8. 2582499Domain d2xrxe2: 2xrx E:180-459 [198643]
    Other proteins in same PDB: d2xrxa1, d2xrxb_, d2xrxc1, d2xrxd_, d2xrxe1, d2xrxf_, d2xrxg1, d2xrxh_, d2xrxi1, d2xrxj_, d2xrxk1, d2xrxl_, d2xrxm1, d2xrxn_, d2xrxo1, d2xrxp_, d2xrxq1, d2xrxr_, d2xrxs1, d2xrxt_, d2xrxu1, d2xrxv_, d2xrxw1, d2xrxx_
    automated match to d1wqla2
    complexed with bnl, fe2, fes

Details for d2xrxe2

PDB Entry: 2xrx (more details), 2.42 Å

PDB Description: crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400
PDB Compounds: (E:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xrxe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xrxe2 d.129.3.0 (E:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

SCOPe Domain Coordinates for d2xrxe2:

Click to download the PDB-style file with coordinates for d2xrxe2.
(The format of our PDB-style files is described here.)

Timeline for d2xrxe2: