| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
| Protein Large subunit of cumene dioxygenase cumA1 [143825] (1 species) |
| Species Pseudomonas fluorescens [TaxId:294] [143826] (1 PDB entry) Uniprot Q51743 181-459 |
| Domain d1wqla2: 1wql A:181-459 [121171] Other proteins in same PDB: d1wqla1, d1wqlb1 complexed with fe2, fes, oxy |
PDB Entry: 1wql (more details), 2.2 Å
SCOPe Domain Sequences for d1wqla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wqla2 d.129.3.3 (A:181-459) Large subunit of cumene dioxygenase cumA1 {Pseudomonas fluorescens [TaxId: 294]}
apdlktylsdatpymdvmldrteavtqvitgmqktvipcnwkfaaeqfcsdmyhagtmah
lsgvlsslppemdlsqvklpssgnqfrakwgghgtgwfnddfallqaimgpkvvdywtkg
paaerakerlgkvlpadrmvaqhmtifptcsflpgintvrtwhprgpneievwsfivvda
dapedikeeyrrkniftfnqggtyeqddgenwvevqrglrgykarsrplcaqmgagvpnk
nnpefpgktsyvyseeaargfyhhwsrmmsepswdtlks
Timeline for d1wqla2: