SCOPe 2.07: Domain d2xrxv_: 2xrx V:

Lineage for d2xrxv_ (2xrx V:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein automated matches [190223] (5 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries)

8. Domain d2xrxv_: 2xrx V: [170345]
   Other proteins in same PDB: d2xrxa1, d2xrxa2, d2xrxc1, d2xrxc2, d2xrxe1, d2xrxe2, d2xrxg1, d2xrxg2, d2xrxi1, d2xrxi2, d2xrxk1, d2xrxk2, d2xrxm1, d2xrxm2, d2xrxo1, d2xrxo2, d2xrxq1, d2xrxq2, d2xrxs1, d2xrxs2, d2xrxu1, d2xrxu2, d2xrxw1, d2xrxw2
   automated match to d1wqlb1
   complexed with bnl, fe2, fes

Details for d2xrxv_

PDB Entry: 2xrx, 2.42 Å

PDB Description: crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400

PDB Compounds: (V:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2xrxv_:

Sequence; same for both SEQRES and ATOM records:

>d2xrxv_ d.17.4.4 (V:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmir
egeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdt
fevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmf
f

Timeline for d2xrxv_:

• d2xrxv_ first appeared in SCOPe 2.01
  
• d2xrxv_ appears in SCOPe 2.06
  
• d2xrxv_ appears in the current release, SCOPe 2.08