SCOPe 2.08: Domain d2xr8u1: 2xr8 U:18-179

Lineage for d2xr8u1 (2xr8 U:18-179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (13 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries)

8. Domain d2xr8u1: 2xr8 U:18-179 [198634]
   Other proteins in same PDB: d2xr8a2, d2xr8b_, d2xr8c2, d2xr8d_, d2xr8e2, d2xr8f_, d2xr8g2, d2xr8h_, d2xr8i2, d2xr8j_, d2xr8k2, d2xr8l_, d2xr8m2, d2xr8n_, d2xr8o2, d2xr8p_, d2xr8q2, d2xr8r_, d2xr8s2, d2xr8t_, d2xr8u2, d2xr8v_, d2xr8w2, d2xr8x_
   automated match to d1wqla1
   complexed with fe2, fes

Details for d2xr8u1

PDB Entry: 2xr8, 2.49 Å

PDB Description: crystal structure of biphenyl dioxygenase from burkholderia xenovorans lb400

PDB Compounds: (U:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xr8u1:

Sequence, based on SEQRES records:

>d2xr8u1 b.33.1.0 (U:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records):

>d2xr8u1 b.33.1.0 (U:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

Timeline for d2xr8u1:

• d2xr8u1 first appeared in SCOPe 2.03
  
• d2xr8u1 appears in SCOPe 2.07