Class b: All beta proteins [48724] (178 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (13 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries) |
Domain d2xr8u1: 2xr8 U:18-179 [198634] Other proteins in same PDB: d2xr8a2, d2xr8b_, d2xr8c2, d2xr8d_, d2xr8e2, d2xr8f_, d2xr8g2, d2xr8h_, d2xr8i2, d2xr8j_, d2xr8k2, d2xr8l_, d2xr8m2, d2xr8n_, d2xr8o2, d2xr8p_, d2xr8q2, d2xr8r_, d2xr8s2, d2xr8t_, d2xr8u2, d2xr8v_, d2xr8w2, d2xr8x_ automated match to d1wqla1 complexed with fe2, fes |
PDB Entry: 2xr8 (more details), 2.49 Å
SCOPe Domain Sequences for d2xr8u1:
Sequence, based on SEQRES records: (download)
>d2xr8u1 b.33.1.0 (U:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]} nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq
>d2xr8u1 b.33.1.0 (U:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]} nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp fekeaffdkaewgplqarvatykglvfanwdvq
Timeline for d2xr8u1:
View in 3D Domains from other chains: (mouse over for more information) d2xr8a1, d2xr8a2, d2xr8b_, d2xr8c1, d2xr8c2, d2xr8d_, d2xr8e1, d2xr8e2, d2xr8f_, d2xr8g1, d2xr8g2, d2xr8h_, d2xr8i1, d2xr8i2, d2xr8j_, d2xr8k1, d2xr8k2, d2xr8l_, d2xr8m1, d2xr8m2, d2xr8n_, d2xr8o1, d2xr8o2, d2xr8p_, d2xr8q1, d2xr8q2, d2xr8r_, d2xr8s1, d2xr8s2, d2xr8t_, d2xr8v_, d2xr8w1, d2xr8w2, d2xr8x_ |