Lineage for d2xr8k2 (2xr8 K:180-459)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539012Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2539333Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2539334Protein automated matches [190218] (22 species)
    not a true protein
  7. 2539337Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)
  8. 2539385Domain d2xr8k2: 2xr8 K:180-459 [198625]
    Other proteins in same PDB: d2xr8a1, d2xr8b_, d2xr8c1, d2xr8d_, d2xr8e1, d2xr8f_, d2xr8g1, d2xr8h_, d2xr8i1, d2xr8j_, d2xr8k1, d2xr8l_, d2xr8m1, d2xr8n_, d2xr8o1, d2xr8p_, d2xr8q1, d2xr8r_, d2xr8s1, d2xr8t_, d2xr8u1, d2xr8v_, d2xr8w1, d2xr8x_
    automated match to d1wqla2
    complexed with fe2, fes

Details for d2xr8k2

PDB Entry: 2xr8 (more details), 2.49 Å

PDB Description: crystal structure of biphenyl dioxygenase from burkholderia xenovorans lb400
PDB Compounds: (K:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xr8k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xr8k2 d.129.3.0 (K:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

SCOPe Domain Coordinates for d2xr8k2:

Click to download the PDB-style file with coordinates for d2xr8k2.
(The format of our PDB-style files is described here.)

Timeline for d2xr8k2: