SCOPe 2.08: Domain d2xr8g2: 2xr8 G:180-459

Lineage for d2xr8g2 (2xr8 G:180-459)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)

8. Domain d2xr8g2: 2xr8 G:180-459 [198621]
   Other proteins in same PDB: d2xr8a1, d2xr8b_, d2xr8c1, d2xr8d_, d2xr8e1, d2xr8f_, d2xr8g1, d2xr8h_, d2xr8i1, d2xr8j_, d2xr8k1, d2xr8l_, d2xr8m1, d2xr8n_, d2xr8o1, d2xr8p_, d2xr8q1, d2xr8r_, d2xr8s1, d2xr8t_, d2xr8u1, d2xr8v_, d2xr8w1, d2xr8x_
   automated match to d1wqla2
   complexed with fe2, fes

Details for d2xr8g2

PDB Entry: 2xr8, 2.49 Å

PDB Description: crystal structure of biphenyl dioxygenase from burkholderia xenovorans lb400

PDB Compounds: (G:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xr8g2:

Sequence; same for both SEQRES and ATOM records:

>d2xr8g2 d.129.3.0 (G:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

Timeline for d2xr8g2:

• d2xr8g2 first appeared in SCOPe 2.03
  
• d2xr8g2 appears in SCOPe 2.07